Campfire Fire Crackling 14
CC0 — Free for any use4.0s
Hotlinking welcome — the URL is permanent, immutable and CORS-enabled.
AI generation prompt
campfire fire crackling sound effect, subtle room reverb, natural space, clean recording, no music, no speech
Generated with stable-audio-3-small-sfx · 4.0s · Public domain (CC0 1.0) — use it in commercial projects, games, videos and apps with no attribution.
Character: bright · punchy · short decay (attack 10ms · tail 420ms · brightness 5.4kHz)
Common uses: fireplace and campfire scenes, spell and energy effects in games, sci-fi machinery and shields, electrical hazard moments.
campfirecracklefire-electricreverbroom