Campfire Fire Crackling 20
CC0 — Free for any use5.0s
Hotlinking welcome — the URL is permanent, immutable and CORS-enabled.
AI generation prompt
campfire fire crackling sound effect, subtle room reverb, natural space, deep low-end emphasis, clean recording, no music, no speech
Generated with stable-audio-3-small-sfx · 5.0s · Public domain (CC0 1.0) — use it in commercial projects, games, videos and apps with no attribution.
Character: balanced · gradual · sustained (attack 3580ms · tail 1020ms · brightness 2.3kHz)
Common uses: fireplace and campfire scenes, spell and energy effects in games, sci-fi machinery and shields, electrical hazard moments.
campfirecrackledeepfire-electricreverbroom