Welding Electric Spark 03
CC0 — Free for any useHotlinking welcome — the URL is permanent, immutable and CORS-enabled.
AI generation prompt
welding electric spark sound effect, close-up, dry studio recording, crisp, clean recording, no music, no speech
Generated with stable-audio-3-small-sfx · 7.0s · Public domain (CC0 1.0) — use it in commercial projects, games, videos and apps with no attribution.
Character: bright · gradual · sustained (attack 2860ms · tail 3240ms · brightness 6.6kHz)
Common uses: fireplace and campfire scenes, spell and energy effects in games, sci-fi machinery and shields, electrical hazard moments.
closedryfire-electricsparkwelding
More electric spark variations
Crackling Burst Electric Spark 01
5.0s · CC0
Short-Circuit Electric Spark 02
3.0s · CC0
Crackling Burst Electric Spark 04
5.0s · CC0
Welding Electric Spark 05
8.0s · CC0
Welding Electric Spark 06
8.0s · CC0
Static Discharge Electric Spark 07
6.0s · CC0
Single Snap Electric Spark 08
5.0s · CC0
Short-Circuit Electric Spark 09
7.0s · CC0