SFXMint

Heavy Cannon Sci-Fi Laser Blast 03

CC0 — Free for any use
5.0s
Download MP3Download WAV

Hotlinking welcome — the URL is permanent, immutable and CORS-enabled.

AI generation prompt

heavy cannon sci-fi laser blast sound effect, close-up, dry studio recording, crisp, deep low-end emphasis, clean recording, no music, no speech

Generated with stable-audio-3-small-sfx · 5.0s · Public domain (CC0 1.0) — use it in commercial projects, games, videos and apps with no attribution.

Character: balanced · gradual · sustained (attack 290ms · tail 2510ms · brightness 1.6kHz)

Common uses: spellcasting and abilities in games, sci-fi weapons and shields, portal and teleport VFX, fantasy UI and menu magic.

closedeepdryheavylasermagic-scifi

More sci-fi laser blast variations

All 35 sci-fi laser blast variations →