Heavy Cannon Sci-Fi Laser Blast 03
CC0 — Free for any useHotlinking welcome — the URL is permanent, immutable and CORS-enabled.
AI generation prompt
heavy cannon sci-fi laser blast sound effect, close-up, dry studio recording, crisp, deep low-end emphasis, clean recording, no music, no speech
Generated with stable-audio-3-small-sfx · 5.0s · Public domain (CC0 1.0) — use it in commercial projects, games, videos and apps with no attribution.
Character: balanced · gradual · sustained (attack 290ms · tail 2510ms · brightness 1.6kHz)
Common uses: spellcasting and abilities in games, sci-fi weapons and shields, portal and teleport VFX, fantasy UI and menu magic.
closedeepdryheavylasermagic-scifi
More sci-fi laser blast variations
Rapid Fire Sci-Fi Laser Blast 01
2.0s · CC0
Charging Then Firing Sci-Fi Laser Blast 02
4.0s · CC0
Thin Piercing Sci-Fi Laser Blast 04
4.0s · CC0
Heavy Cannon Sci-Fi Laser Blast 05
4.0s · CC0
Single Shot Sci-Fi Laser Blast 06
4.0s · CC0
Heavy Cannon Sci-Fi Laser Blast 07
5.0s · CC0
Heavy Cannon Sci-Fi Laser Blast 08
4.0s · CC0
Thin Piercing Sci-Fi Laser Blast 09
4.0s · CC0