SFXMint

Fiery Magic Spell Cast 30

CC0 — Free for any use
4.0s
Download MP3Download WAV

Hotlinking welcome — the URL is permanent, immutable and CORS-enabled.

AI generation prompt

fiery magic spell cast sound effect, close-up, dry studio recording, crisp, warm rounded tone, clean recording, no music, no speech

Generated with stable-audio-3-small-sfx · 4.0s · Public domain (CC0 1.0) — use it in commercial projects, games, videos and apps with no attribution.

Character: bright · gradual · sustained (attack 530ms · tail 2560ms · brightness 5.0kHz)

Common uses: spellcasting and abilities in games, sci-fi weapons and shields, portal and teleport VFX, fantasy UI and menu magic.

closedryfierymagic-scifispellwarm

More magic spell cast variations

All 35 magic spell cast variations →