Fiery Magic Spell Cast 30
CC0 — Free for any useHotlinking welcome — the URL is permanent, immutable and CORS-enabled.
AI generation prompt
fiery magic spell cast sound effect, close-up, dry studio recording, crisp, warm rounded tone, clean recording, no music, no speech
Generated with stable-audio-3-small-sfx · 4.0s · Public domain (CC0 1.0) — use it in commercial projects, games, videos and apps with no attribution.
Character: bright · gradual · sustained (attack 530ms · tail 2560ms · brightness 5.0kHz)
Common uses: spellcasting and abilities in games, sci-fi weapons and shields, portal and teleport VFX, fantasy UI and menu magic.
closedryfierymagic-scifispellwarm
More magic spell cast variations
Fiery Magic Spell Cast 01
4.0s · CC0
Healing Warm Magic Spell Cast 02
4.0s · CC0
Icy Crystalline Magic Spell Cast 03
5.0s · CC0
Icy Crystalline Magic Spell Cast 04
5.0s · CC0
Sparkling Magic Spell Cast 05
5.0s · CC0
Fiery Magic Spell Cast 06
4.0s · CC0
Fiery Magic Spell Cast 07
4.0s · CC0
Healing Warm Magic Spell Cast 08
4.0s · CC0