SFXMint

Fingernail Tapping On Glass 42

CC0 — Free for any use
2.0s
Download MP3Download WAV

Hotlinking welcome — the URL is permanent, immutable and CORS-enabled.

AI generation prompt

fingernail tapping on glass sound effect, close-up, dry studio recording, crisp, warm rounded tone, clean recording, no music, no speech

Generated with stable-audio-3-small-sfx · 2.0s · Public domain (CC0 1.0) — use it in commercial projects, games, videos and apps with no attribution.

Character: bright · gradual · short decay (attack 650ms · tail 160ms · brightness 5.0kHz)

Common uses: kitchen and drink scenes, breakage moments in games and film, fragile-item UI warnings, puzzle-game feedback.

closedryfingernailglassglass-tapwarm

More tapping on glass variations

All 41 tapping on glass variations →